SCOPe 2.07: Domain d1tlva2: 1tlv A:169-274

Lineage for d1tlva2 (1tlv A:169-274)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily)
   core: 4 helices; bundle, closed, right-handed twist; 1 crossover connection

4. Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF00874

5. Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein)

6. Protein Transcriptional antiterminator LicT [63522] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [63523] (2 PDB entries)

8. Domain d1tlva2: 1tlv A:169-274 [119303]
   Other proteins in same PDB: d1tlva3
   automated match to d1h99a2

Details for d1tlva2

PDB Entry: 1tlv, 1.95 Å

PDB Description: Structure of the native and inactive LicT PRD from B. subtilis

PDB Compounds: (A:) transcription antiterminator lict

SCOPe Domain Sequences for d1tlva2:

Sequence, based on SEQRES records:

>d1tlva2 a.142.1.1 (A:169-274) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]}
mpniinitkvmqeilsivkyhfkiefneeslhyyrfvthlkffaqrlfngthmesqddfl
ldtvkekyhrayectkkiqtyiereyehkltsdellyltihiervv

Sequence, based on observed residues (ATOM records):

>d1tlva2 a.142.1.1 (A:169-274) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]}
mpniinitkvmqeilsivkyhfkiefnslhyyrfvthlkffaqrlfngthmyhrayectk
kiqtyiereyehkltsdellyltihiervv

Timeline for d1tlva2:

• d1tlva2 first appeared in SCOP 1.73
  
• d1tlva2 appears in SCOPe 2.06
  
• d1tlva2 appears in the current release, SCOPe 2.08