Lineage for d1tlva1 (1tlv A:54-168)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778849Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily)
    core: 4 helices; bundle, closed, right-handed twist; 1 crossover connection
  4. 778850Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 778851Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein)
  6. 778852Protein Transcriptional antiterminator LicT [63522] (1 species)
  7. 778853Species Bacillus subtilis [TaxId:1423] [63523] (2 PDB entries)
  8. 778856Domain d1tlva1: 1tlv A:54-168 [119302]
    automatically matched to d1h99a1

Details for d1tlva1

PDB Entry: 1tlv (more details), 1.95 Å

PDB Description: Structure of the native and inactive LicT PRD from B. subtilis
PDB Compounds: (A:) transcription antiterminator lict

SCOP Domain Sequences for d1tlva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlva1 a.142.1.1 (A:54-168) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]}
gamekfktllydipiecmevseeiisyaklqlgkklndsiyvsltdhinfaiqrnqkgld
iknallwetkrlykdefaigkealvmvknktgvslpedeagfialhivnaelnee

SCOP Domain Coordinates for d1tlva1:

Click to download the PDB-style file with coordinates for d1tlva1.
(The format of our PDB-style files is described here.)

Timeline for d1tlva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tlva2