SCOP 1.73: Domain d1tlva1: 1tlv A:54-168

Lineage for d1tlva1 (1tlv A:54-168)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily)
   core: 4 helices; bundle, closed, right-handed twist; 1 crossover connection

4. Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family)
   duplication: consists of two domains of this fold

5. Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein)

6. Protein Transcriptional antiterminator LicT [63522] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [63523] (2 PDB entries)

8. Domain d1tlva1: 1tlv A:54-168 [119302]
   automatically matched to d1h99a1

Details for d1tlva1

PDB Entry: 1tlv, 1.95 Å

PDB Description: Structure of the native and inactive LicT PRD from B. subtilis

PDB Compounds: (A:) transcription antiterminator lict

SCOP Domain Sequences for d1tlva1:

Sequence; same for both SEQRES and ATOM records:

>d1tlva1 a.142.1.1 (A:54-168) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]}
gamekfktllydipiecmevseeiisyaklqlgkklndsiyvsltdhinfaiqrnqkgld
iknallwetkrlykdefaigkealvmvknktgvslpedeagfialhivnaelnee

Timeline for d1tlva1:

• d1tlva1 is new in SCOP 1.73
  
• d1tlva1 appears in SCOP 1.75
  
• d1tlva1 appears in the current release, SCOPe 2.08