Class a: All alpha proteins [46456] (290 folds) |
Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily) core: 4 helices; bundle, closed, right-handed twist; 1 crossover connection |
Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family) duplication: consists of two domains of this fold automatically mapped to Pfam PF00874 |
Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein) |
Protein Transcriptional antiterminator LicT [63522] (1 species) |
Species Bacillus subtilis [TaxId:1423] [63523] (2 PDB entries) |
Domain d1tlva1: 1tlv A:57-168 [119302] Other proteins in same PDB: d1tlva3 automated match to d1h99a1 |
PDB Entry: 1tlv (more details), 1.95 Å
SCOPe Domain Sequences for d1tlva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tlva1 a.142.1.1 (A:57-168) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]} ekfktllydipiecmevseeiisyaklqlgkklndsiyvsltdhinfaiqrnqkgldikn allwetkrlykdefaigkealvmvknktgvslpedeagfialhivnaelnee
Timeline for d1tlva1: