Lineage for d1tlva1 (1tlv A:57-168)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013105Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily)
    core: 4 helices; bundle, closed, right-handed twist; 1 crossover connection
  4. 2013106Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF00874
  5. 2013107Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein)
  6. 2013108Protein Transcriptional antiterminator LicT [63522] (1 species)
  7. 2013109Species Bacillus subtilis [TaxId:1423] [63523] (2 PDB entries)
  8. 2013112Domain d1tlva1: 1tlv A:57-168 [119302]
    Other proteins in same PDB: d1tlva3
    automated match to d1h99a1

Details for d1tlva1

PDB Entry: 1tlv (more details), 1.95 Å

PDB Description: Structure of the native and inactive LicT PRD from B. subtilis
PDB Compounds: (A:) transcription antiterminator lict

SCOPe Domain Sequences for d1tlva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlva1 a.142.1.1 (A:57-168) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]}
ekfktllydipiecmevseeiisyaklqlgkklndsiyvsltdhinfaiqrnqkgldikn
allwetkrlykdefaigkealvmvknktgvslpedeagfialhivnaelnee

SCOPe Domain Coordinates for d1tlva1:

Click to download the PDB-style file with coordinates for d1tlva1.
(The format of our PDB-style files is described here.)

Timeline for d1tlva1: