Lineage for d1tl8a3 (1tl8 A:201-430)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624070Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 2624071Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
    automatically mapped to Pfam PF02919
  5. 2624072Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 2624073Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 2624076Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 2624086Domain d1tl8a3: 1tl8 A:201-430 [119301]
    Other proteins in same PDB: d1tl8a1, d1tl8a2
    automatically matched to d1k4sa2
    protein/DNA complex; complexed with ai3

Details for d1tl8a3

PDB Entry: 1tl8 (more details), 3.1 Å

PDB Description: Human DNA topoisomerase I (70 kDa) in complex with the indenoisoquinoline AI-III-52 and covalent complex with a 22 base pair DNA duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1tl8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tl8a3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOPe Domain Coordinates for d1tl8a3:

Click to download the PDB-style file with coordinates for d1tl8a3.
(The format of our PDB-style files is described here.)

Timeline for d1tl8a3: