Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily) 2 domains: alpha+beta and all-beta |
Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) automatically mapped to Pfam PF02919 |
Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein) |
Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries) Uniprot P11387 203-765 ! Uniprot P11387 203-767 |
Domain d1tl8a3: 1tl8 A:201-430 [119301] Other proteins in same PDB: d1tl8a1, d1tl8a2 automatically matched to d1k4sa2 protein/DNA complex; complexed with ai3 |
PDB Entry: 1tl8 (more details), 3.1 Å
SCOPe Domain Sequences for d1tl8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tl8a3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]} qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln
Timeline for d1tl8a3: