SCOPe 2.07: Domain d1tl8a2: 1tl8 A:431-633,A:714-765

Lineage for d1tl8a2 (1tl8 A:431-633,A:714-765)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)

6. Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
   Uniprot P11387 203-765 ! Uniprot P11387 203-767

8. Domain d1tl8a2: 1tl8 A:431-633,A:714-765 [119300]
   Other proteins in same PDB: d1tl8a1, d1tl8a3
   automatically matched to d1ej9a1
   protein/DNA complex; complexed with ai3

Details for d1tl8a2

PDB Entry: 1tl8, 3.1 Å

PDB Description: Human DNA topoisomerase I (70 kDa) in complex with the indenoisoquinoline AI-III-52 and covalent complex with a 22 base pair DNA duplex

PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1tl8a2:

Sequence; same for both SEQRES and ATOM records:

>d1tl8a2 d.163.1.2 (A:431-633,A:714-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqXialgtsklnyldpritvawckkwgvpiekiynktqr
ekfawaidmadedyef

Timeline for d1tl8a2:

• d1tl8a2 first appeared in SCOP 1.73
  
• d1tl8a2 appears in SCOPe 2.06
  
• d1tl8a2 appears in the current release, SCOPe 2.08