Lineage for d1tl8a2 (1tl8 A:431-633,A:714-765)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 877365Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 877366Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 877453Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 877454Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 877455Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
    Uniprot P11387 203-765
    Uniprot P11387 203-767
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 877465Domain d1tl8a2: 1tl8 A:431-633,A:714-765 [119300]
    Other proteins in same PDB: d1tl8a1, d1tl8a3
    automatically matched to d1ej9a1
    complexed with ai3, tpc

Details for d1tl8a2

PDB Entry: 1tl8 (more details), 3.1 Å

PDB Description: Human DNA topoisomerase I (70 kDa) in complex with the indenoisoquinoline AI-III-52 and covalent complex with a 22 base pair DNA duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOP Domain Sequences for d1tl8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tl8a2 d.163.1.2 (A:431-633,A:714-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqXialgtsklnyldpritvawckkwgvpiekiynktqr
ekfawaidmadedyef

SCOP Domain Coordinates for d1tl8a2:

Click to download the PDB-style file with coordinates for d1tl8a2.
(The format of our PDB-style files is described here.)

Timeline for d1tl8a2: