![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
![]() | Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) ![]() |
![]() | Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein) |
![]() | Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries) Uniprot P11387 203-765 Uniprot P11387 203-767 Uniprot P11387 203-765 ! Uniprot P11387 203-767 |
![]() | Domain d1tl8a2: 1tl8 A:431-633,A:714-765 [119300] Other proteins in same PDB: d1tl8a1, d1tl8a3 automatically matched to d1ej9a1 complexed with ai3, tpc |
PDB Entry: 1tl8 (more details), 3.1 Å
SCOP Domain Sequences for d1tl8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tl8a2 d.163.1.2 (A:431-633,A:714-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]} pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde nipakilsynranravailcnhqXialgtsklnyldpritvawckkwgvpiekiynktqr ekfawaidmadedyef
Timeline for d1tl8a2: