Lineage for d1tl8a1 (1tl8 A:636-712)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689995Superfamily a.2.8: Eukaryotic DNA topoisomerase I, dispensable insert domain [46596] (1 family) (S)
  5. 2689996Family a.2.8.1: Eukaryotic DNA topoisomerase I, dispensable insert domain [46597] (1 protein)
  6. 2689997Protein Eukaryotic DNA topoisomerase I, dispensable insert domain [46598] (1 species)
  7. 2689998Species Human (Homo sapiens) [TaxId:9606] [46599] (9 PDB entries)
    Uniprot P11387 203-767
  8. 2690004Domain d1tl8a1: 1tl8 A:636-712 [119299]
    Other proteins in same PDB: d1tl8a2, d1tl8a3
    automatically matched to d1rrja1
    protein/DNA complex; complexed with ai3

Details for d1tl8a1

PDB Entry: 1tl8 (more details), 3.1 Å

PDB Description: Human DNA topoisomerase I (70 kDa) in complex with the indenoisoquinoline AI-III-52 and covalent complex with a 22 base pair DNA duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1tl8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tl8a1 a.2.8.1 (A:636-712) Eukaryotic DNA topoisomerase I, dispensable insert domain {Human (Homo sapiens) [TaxId: 9606]}
ppktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskkkavqrle
eqlmklevqatdreenk

SCOPe Domain Coordinates for d1tl8a1:

Click to download the PDB-style file with coordinates for d1tl8a1.
(The format of our PDB-style files is described here.)

Timeline for d1tl8a1: