SCOP 1.75: Domain d1tkwa1: 1tkw A:1-99

Lineage for d1tkwa1 (1tkw A:1-99)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (14 species)

7. Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (10 PDB entries)

8. Domain d1tkwa1: 1tkw A:1-99 [119297]
   automatically matched to d1plc__
   complexed with cu, hec

Details for d1tkwa1

PDB Entry: 1tkw

PDB Description: the transient complex of poplar plastocyanin with turnip cytochrome f determined with paramagnetic nmr

PDB Compounds: (A:) plastocyanin a

SCOP Domain Sequences for d1tkwa1:

Sequence; same for both SEQRES and ATOM records:

>d1tkwa1 b.6.1.1 (A:1-99) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

Timeline for d1tkwa1:

• d1tkwa1 first appeared in SCOP 1.73
  
• d1tkwa1 appears in SCOPe 2.01
  
• d1tkwa1 appears in the current release, SCOPe 2.08, called d1tkwa_