SCOPe 2.08: Domain d1tkja_: 1tkj A:

Lineage for d1tkja_ (1tkj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein automated matches [190049] (2 species)
   not a true protein

7. Species Streptomyces griseus [TaxId:1911] [186770] (6 PDB entries)

8. Domain d1tkja_: 1tkj A: [119296]
   automated match to d1cp7a_
   complexed with ca, med, zn

Details for d1tkja_

PDB Entry: 1tkj, 1.15 Å

PDB Description: Streptomyces griseus aminopeptidase complexed with D-Methionine

PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d1tkja_:

Sequence; same for both SEQRES and ATOM records:

>d1tkja_ c.56.5.4 (A:) automated matches {Streptomyces griseus [TaxId: 1911]}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

Timeline for d1tkja_:

• d1tkja_ first appeared in SCOP 1.73, called d1tkja1
  
• d1tkja_ appears in SCOPe 2.07