Lineage for d1tjrb_ (1tjr B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079697Protein automated matches [190053] (9 species)
    not a true protein
  7. 2079712Species Maize (Zea mays) [TaxId:4577] [186774] (1 PDB entry)
  8. 2079713Domain d1tjrb_: 1tjr B: [119293]
    Other proteins in same PDB: d1tjra1
    automated match to d1rd5a_
    complexed with so4

Details for d1tjrb_

PDB Entry: 1tjr (more details), 2.3 Å

PDB Description: Crystal structure of wild-type BX1 complexed with a sulfate ion
PDB Compounds: (B:) bx1

SCOPe Domain Sequences for d1tjrb_:

Sequence, based on SEQRES records: (download)

>d1tjrb_ c.1.2.4 (B:) automated matches {Maize (Zea mays) [TaxId: 4577]}
srpvsdtmaalmakgktafipyitagdpdlattaealrlldgcgadvielgvpcsdpyid
gpiiqasvaralasgttmdavlemlrevtpelscpvvllsyykpimsrslaemkeagvhg
livpdlpyvaahslwseaknnnlelvllttpaipedrmkeitkasegfvylvsvngvtgp
ranvnprvesliqevkkvtnkpvavgfgiskpehvkqiaqwgadgviigsamvrqlgeaa
spkqglrrleeyargmknalp

Sequence, based on observed residues (ATOM records): (download)

>d1tjrb_ c.1.2.4 (B:) automated matches {Maize (Zea mays) [TaxId: 4577]}
srpvsdtmaalmakgktafipyitagdpdlattaealrlldgcgadvielgvpcsdpyid
gpiiqasvaralasgttmdavlemlrevtpelscpvvllsyymsrslaemkeagvhgliv
pdlpyvaahslwseaknnnlelvllttpaipedrmkeitkasegfvylvsvngvtgpvnp
rvesliqevkkvtnkpvavgfgiskpehvkqiaqwgadgviigsamvrqlgeaaspkqgl
rrleeyargmknalp

SCOPe Domain Coordinates for d1tjrb_:

Click to download the PDB-style file with coordinates for d1tjrb_.
(The format of our PDB-style files is described here.)

Timeline for d1tjrb_: