Lineage for d1tjpb_ (1tjp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2140010Protein automated matches [190054] (13 species)
    not a true protein
  7. 2140047Species Salmonella typhimurium [TaxId:90371] [189633] (13 PDB entries)
  8. 2140048Domain d1tjpb_: 1tjp B: [119291]
    Other proteins in same PDB: d1tjpa_
    automated match to d2tysb_
    complexed with hpf, na, plp

Details for d1tjpb_

PDB Entry: 1tjp (more details), 1.5 Å

PDB Description: Crystal Structure Of Wild-Type Tryptophan Synthase Complexed With 1-[(2-hydroxylphenyl)amino]3-glycerolphosphate
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d1tjpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjpb_ c.79.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg

SCOPe Domain Coordinates for d1tjpb_:

Click to download the PDB-style file with coordinates for d1tjpb_.
(The format of our PDB-style files is described here.)

Timeline for d1tjpb_: