Lineage for d1tjpa_ (1tjp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827194Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2827224Protein Trp synthase alpha-subunit [51388] (9 species)
  7. 2827273Species Salmonella typhimurium [TaxId:90371] [51389] (72 PDB entries)
  8. 2827276Domain d1tjpa_: 1tjp A: [119290]
    Other proteins in same PDB: d1tjpb_
    automated match to d1a5aa_
    complexed with hpf, na, plp

Details for d1tjpa_

PDB Entry: 1tjp (more details), 1.5 Å

PDB Description: Crystal Structure Of Wild-Type Tryptophan Synthase Complexed With 1-[(2-hydroxylphenyl)amino]3-glycerolphosphate
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d1tjpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasr

SCOPe Domain Coordinates for d1tjpa_:

Click to download the PDB-style file with coordinates for d1tjpa_.
(The format of our PDB-style files is described here.)

Timeline for d1tjpa_: