Lineage for d1tjfb_ (1tjf B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349297Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
    6 helices: bundle; left-handed twist, up-and-down topology
  4. 2349298Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (2 families) (S)
    automatically mapped to Pfam PF01213
  5. 2349299Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)
  6. 2349300Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)
  7. 2349301Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (3 PDB entries)
  8. 2349307Domain d1tjfb_: 1tjf B: [119289]
    automated match to d1s0pa_
    complexed with so4

Details for d1tjfb_

PDB Entry: 1tjf (more details), 2.21 Å

PDB Description: The crystal structure of the N-terminal domain of CAP indicates variable oligomerisation
PDB Compounds: (B:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1tjfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjfb_ a.192.1.1 (B:) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
sgaagpssasvkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqs
kkpsqetllelikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgph
vaemrgsaefytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggd
aksatp

SCOPe Domain Coordinates for d1tjfb_:

Click to download the PDB-style file with coordinates for d1tjfb_.
(The format of our PDB-style files is described here.)

Timeline for d1tjfb_: