![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily) 6 helices: bundle; left-handed twist, up-and-down topology |
![]() | Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (2 families) ![]() automatically mapped to Pfam PF01213 |
![]() | Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein) |
![]() | Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (3 PDB entries) |
![]() | Domain d1tjfb_: 1tjf B: [119289] automated match to d1s0pa_ complexed with so4 |
PDB Entry: 1tjf (more details), 2.21 Å
SCOPe Domain Sequences for d1tjfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjfb_ a.192.1.1 (B:) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} sgaagpssasvkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqs kkpsqetllelikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgph vaemrgsaefytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggd aksatp
Timeline for d1tjfb_: