Lineage for d1tjfb1 (1tjf B:51-226)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779963Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
    6 helices: bundle; left-handed twist, up-and-down topology
  4. 779964Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (1 family) (S)
  5. 779965Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)
  6. 779966Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)
  7. 779967Species Dictyostelium discoideum [TaxId:44689] [101281] (2 PDB entries)
  8. 779971Domain d1tjfb1: 1tjf B:51-226 [119289]
    automatically matched to d1s0pa_
    complexed with so4

Details for d1tjfb1

PDB Entry: 1tjf (more details), 2.21 Å

PDB Description: The crystal structure of the N-terminal domain of CAP indicates variable oligomerisation
PDB Compounds: (B:) Adenylyl cyclase-associated protein

SCOP Domain Sequences for d1tjfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjfb1 a.192.1.1 (B:51-226) N-terminal domain of adenylylcyclase associated protein, CAP {Dictyostelium discoideum [TaxId: 44689]}
svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat

SCOP Domain Coordinates for d1tjfb1:

Click to download the PDB-style file with coordinates for d1tjfb1.
(The format of our PDB-style files is described here.)

Timeline for d1tjfb1: