SCOP 1.73: Domain d1tjfa1: 1tjf A:51-226

Lineage for d1tjfa1 (1tjf A:51-226)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
   6 helices: bundle; left-handed twist, up-and-down topology

4. Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (1 family)

5. Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)

6. Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (2 PDB entries)

8. Domain d1tjfa1: 1tjf A:51-226 [119288]
   automatically matched to d1s0pa_
   complexed with so4

Details for d1tjfa1

PDB Entry: 1tjf, 2.21 Å

PDB Description: The crystal structure of the N-terminal domain of CAP indicates variable oligomerisation

PDB Compounds: (A:) Adenylyl cyclase-associated protein

SCOP Domain Sequences for d1tjfa1:

Sequence; same for both SEQRES and ATOM records:

>d1tjfa1 a.192.1.1 (A:51-226) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat

Timeline for d1tjfa1:

• d1tjfa1 is new in SCOP 1.73
  
• d1tjfa1 appears in SCOP 1.75
  
• d1tjfa1 appears in the current release, SCOPe 2.08, called d1tjfa_