Lineage for d1tjfa1 (1tjf A:51-226)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650890Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
    6 helices: bundle; left-handed twist, up-and-down topology
  4. 650891Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (1 family) (S)
  5. 650892Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)
  6. 650893Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)
  7. 650894Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (2 PDB entries)
  8. 650897Domain d1tjfa1: 1tjf A:51-226 [119288]
    automatically matched to d1s0pa_
    complexed with so4

Details for d1tjfa1

PDB Entry: 1tjf (more details), 2.21 Å

PDB Description: The crystal structure of the N-terminal domain of CAP indicates variable oligomerisation
PDB Compounds: (A:) Adenylyl cyclase-associated protein

SCOP Domain Sequences for d1tjfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjfa1 a.192.1.1 (A:51-226) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat

SCOP Domain Coordinates for d1tjfa1:

Click to download the PDB-style file with coordinates for d1tjfa1.
(The format of our PDB-style files is described here.)

Timeline for d1tjfa1:

Domains from other chains:
(mouse over for more information)
d1tjfb1