Lineage for d1tj6b_ (1tj6 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2413229Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2413230Protein automated matches [190052] (8 species)
    not a true protein
  7. 2413480Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [186773] (2 PDB entries)
  8. 2413482Domain d1tj6b_: 1tj6 B: [119287]
    Other proteins in same PDB: d1tj6a1
    automated match to d1evha_

Details for d1tj6b_

PDB Entry: 1tj6 (more details), 1.65 Å

PDB Description: Crystal structure of the Xenopus tropicalis Spred1 EVH-1 domain
PDB Compounds: (B:) Spred1

SCOPe Domain Sequences for d1tj6b_:

Sequence, based on SEQRES records: (download)

>d1tj6b_ b.55.1.0 (B:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
dsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdktvi
lecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

Sequence, based on observed residues (ATOM records): (download)

>d1tj6b_ b.55.1.0 (B:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
dsyarvravvmtrddssggwlqlgggglssvtvsktleflvhgerlrdktvilecvlrrd
lvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

SCOPe Domain Coordinates for d1tj6b_:

Click to download the PDB-style file with coordinates for d1tj6b_.
(The format of our PDB-style files is described here.)

Timeline for d1tj6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tj6a1