Lineage for d1tj6a1 (1tj6 A:9-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803479Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2803506Protein Sprouty-related, EVH1 domain-containing protein 1, Spred-1 [141430] (2 species)
  7. 2803511Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [141431] (2 PDB entries)
    Uniprot Q66JG9 10-123! Uniprot Q66JG9 9-123
  8. 2803513Domain d1tj6a1: 1tj6 A:9-123 [119286]
    Other proteins in same PDB: d1tj6b_

Details for d1tj6a1

PDB Entry: 1tj6 (more details), 1.65 Å

PDB Description: Crystal structure of the Xenopus tropicalis Spred1 EVH-1 domain
PDB Compounds: (A:) Spred1

SCOPe Domain Sequences for d1tj6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tj6a1 b.55.1.4 (A:9-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
dsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdktvi
lecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

SCOPe Domain Coordinates for d1tj6a1:

Click to download the PDB-style file with coordinates for d1tj6a1.
(The format of our PDB-style files is described here.)

Timeline for d1tj6a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tj6b_