Lineage for d1tj3a1 (1tj3 A:1-244)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848143Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 848186Protein Sucrose-phosphatase Slr0953 [142163] (1 species)
  7. 848187Species Synechocystis sp. pcc 6803 [TaxId:1148] [142164] (9 PDB entries)
    Uniprot P74325 1-244
  8. 848194Domain d1tj3a1: 1tj3 A:1-244 [119283]
    automatically matched to 1S2O A:1-244
    complexed with mg

Details for d1tj3a1

PDB Entry: 1tj3 (more details), 2.8 Å

PDB Description: X-Ray structure of the Sucrose-Phosphatase (SPP) from Synechocystis sp. PCC6803 in a closed conformation
PDB Compounds: (A:) Sucrose-Phosphatase

SCOP Domain Sequences for d1tj3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tj3a1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]}
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls

SCOP Domain Coordinates for d1tj3a1:

Click to download the PDB-style file with coordinates for d1tj3a1.
(The format of our PDB-style files is described here.)

Timeline for d1tj3a1: