Lineage for d1ti8b1 (1ti8 B:1-166)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467390Domain d1ti8b1: 1ti8 B:1-166 [119280]
    Other proteins in same PDB: d1ti8a1
    complexed with man, nag, ndg

Details for d1ti8b1

PDB Entry: 1ti8 (more details), 3 Å

PDB Description: H7 Haemagglutinin
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d1ti8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti8b1 h.3.1.1 (B:1-166) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidltdsemnklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreea

SCOPe Domain Coordinates for d1ti8b1:

Click to download the PDB-style file with coordinates for d1ti8b1.
(The format of our PDB-style files is described here.)

Timeline for d1ti8b1: