Lineage for d1ti8a1 (1ti8 A:13-325)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662496Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 662497Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 662542Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 662543Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 662544Species Influenza A virus, different strains [TaxId:11320] [49825] (39 PDB entries)
  8. 662627Domain d1ti8a1: 1ti8 A:13-325 [119279]
    Other proteins in same PDB: d1ti8b1
    complexed with man, nag, ndg

Details for d1ti8a1

PDB Entry: 1ti8 (more details), 3 Å

PDB Description: H7 Haemagglutinin
PDB Compounds: (A:) Hemagglutinin

SCOP Domain Sequences for d1ti8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti8a1 b.19.1.2 (A:13-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
iclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgtitg
ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgirt
ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstteq
tklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfngaf
iapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryvkq
eslmlatgmknvpe

SCOP Domain Coordinates for d1ti8a1:

Click to download the PDB-style file with coordinates for d1ti8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ti8a1: