| Class b: All beta proteins [48724] (174 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
| Species Sulfolobus solfataricus [TaxId:2287] [141290] (1 PDB entry) Uniprot Q97ZQ0 1-76 SnRNP-2 |
| Domain d1th7n_: 1th7 N: [119277] automated match to d1th7a1 |
PDB Entry: 1th7 (more details), 1.68 Å
SCOPe Domain Sequences for d1th7n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1th7n_ b.38.1.1 (N:) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]}
gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
klgtivirgdnvilispl
Timeline for d1th7n_: