Class b: All beta proteins [48724] (177 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
Species Sulfolobus solfataricus [TaxId:2287] [141290] (1 PDB entry) Uniprot Q97ZQ0 1-76 SnRNP-2 |
Domain d1th7b2: 1th7 B:3-78 [119265] Other proteins in same PDB: d1th7a2, d1th7b3, d1th7c3, d1th7d3, d1th7e3, d1th7f3, d1th7g3, d1th7h3, d1th7i3, d1th7j3, d1th7k3, d1th7l3, d1th7m3, d1th7n3 automated match to d1th7a1 |
PDB Entry: 1th7 (more details), 1.68 Å
SCOPe Domain Sequences for d1th7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1th7b2 b.38.1.1 (B:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} mnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgkkl gtivirgdnvilispl
Timeline for d1th7b2:
View in 3D Domains from other chains: (mouse over for more information) d1th7a1, d1th7a2, d1th7c2, d1th7c3, d1th7d2, d1th7d3, d1th7e2, d1th7e3, d1th7f2, d1th7f3, d1th7g2, d1th7g3, d1th7h2, d1th7h3, d1th7i2, d1th7i3, d1th7j2, d1th7j3, d1th7k2, d1th7k3, d1th7l2, d1th7l3, d1th7m2, d1th7m3, d1th7n2, d1th7n3 |