Lineage for d1th7a1 (1th7 A:3-78)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057138Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 2057139Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2057293Species Sulfolobus solfataricus [TaxId:2287] [141290] (1 PDB entry)
    Uniprot Q97ZQ0 1-76
    SnRNP-2
  8. 2057294Domain d1th7a1: 1th7 A:3-78 [119264]
    Other proteins in same PDB: d1th7a2, d1th7b3, d1th7c3, d1th7d3, d1th7e3, d1th7f3, d1th7g3, d1th7h3, d1th7i3, d1th7j3, d1th7k3, d1th7l3, d1th7m3, d1th7n3

Details for d1th7a1

PDB Entry: 1th7 (more details), 1.68 Å

PDB Description: Crystal Structure of an Archaeal Sm Protein from Sulfolobus solfataricus
PDB Compounds: (A:) Small nuclear riboprotein protein

SCOPe Domain Sequences for d1th7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]}
mnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgkkl
gtivirgdnvilispl

SCOPe Domain Coordinates for d1th7a1:

Click to download the PDB-style file with coordinates for d1th7a1.
(The format of our PDB-style files is described here.)

Timeline for d1th7a1: