SCOPe 2.06: Domain d1th7a1: 1th7 A:3-78

Lineage for d1th7a1 (1th7 A:3-78)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
   forms homo and heteroheptameric ring structures

6. Protein Archaeal homoheptameric Sm protein [63758] (6 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141290] (1 PDB entry)
   Uniprot Q97ZQ0 1-76
   SnRNP-2

8. Domain d1th7a1: 1th7 A:3-78 [119264]
   Other proteins in same PDB: d1th7a2, d1th7b3, d1th7c3, d1th7d3, d1th7e3, d1th7f3, d1th7g3, d1th7h3, d1th7i3, d1th7j3, d1th7k3, d1th7l3, d1th7m3, d1th7n3

Details for d1th7a1

PDB Entry: 1th7, 1.68 Å

PDB Description: Crystal Structure of an Archaeal Sm Protein from Sulfolobus solfataricus

PDB Compounds: (A:) Small nuclear riboprotein protein

SCOPe Domain Sequences for d1th7a1:

Sequence; same for both SEQRES and ATOM records:

>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]}
mnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgkkl
gtivirgdnvilispl

Timeline for d1th7a1:

• d1th7a1 first appeared in SCOP 1.73
  
• d1th7a1 appears in SCOPe 2.05
  
• d1th7a1 appears in SCOPe 2.07
  
• d1th7a1 appears in the current release, SCOPe 2.08