Lineage for d1th5a1 (1th5 A:154-226)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025652Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1025810Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 1025811Family d.52.8.1: NifU C-terminal domain-like [117917] (3 proteins)
    Pfam PF01106
  6. 1025815Protein NifU-like protein 1, NIFUL1 [143228] (1 species)
  7. 1025816Species Rice (Oryza sativa) [TaxId:4530] [143229] (1 PDB entry)
    Uniprot Q84LK7 154-226
  8. 1025817Domain d1th5a1: 1th5 A:154-226 [119263]

Details for d1th5a1

PDB Entry: 1th5 (more details)

PDB Description: solution structure of c-terminal domain of nifu-like protein from oryza sativa
PDB Compounds: (A:) NifU1

SCOPe Domain Sequences for d1th5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1th5a1 d.52.8.1 (A:154-226) NifU-like protein 1, NIFUL1 {Rice (Oryza sativa) [TaxId: 4530]}
lelneenvekvlneirpylagtgggglqflmikgpivkvrltgpaavvrtvriavskklr
ekipsiqivqlls

SCOPe Domain Coordinates for d1th5a1:

Click to download the PDB-style file with coordinates for d1th5a1.
(The format of our PDB-style files is described here.)

Timeline for d1th5a1: