Lineage for d1th4a_ (1th4 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2620683Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2620684Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2620685Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2620841Protein automated matches [190051] (12 species)
    not a true protein
  7. 2620844Species Cow (Bos taurus) [TaxId:9913] [186772] (9 PDB entries)
  8. 2620867Domain d1th4a_: 1th4 A: [119259]
    automated match to d1qqwb_
    complexed with 3tr, hem

Details for d1th4a_

PDB Entry: 1th4 (more details), 2.98 Å

PDB Description: crystal structure of NADPH depleted bovine liver catalase complexed with 3-amino-1,2,4-triazole
PDB Compounds: (A:) catalase

SCOPe Domain Sequences for d1th4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1th4a_ e.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
dvhpeygsriqalldkyne

SCOPe Domain Coordinates for d1th4a_:

Click to download the PDB-style file with coordinates for d1th4a_.
(The format of our PDB-style files is described here.)

Timeline for d1th4a_: