Lineage for d1th4a1 (1th4 A:3-501)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742603Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 742604Superfamily e.5.1: Heme-dependent catalase-like [56634] (2 families) (S)
  5. 742605Family e.5.1.1: Heme-dependent catalases [56635] (2 proteins)
  6. 742606Protein Catalase I [56636] (8 species)
  7. 742612Species Cow (Bos taurus) [TaxId:9913] [56637] (7 PDB entries)
  8. 742633Domain d1th4a1: 1th4 A:3-501 [119259]
    automatically matched to d4blca_
    complexed with 3tr, hem

Details for d1th4a1

PDB Entry: 1th4 (more details), 2.98 Å

PDB Description: crystal structure of NADPH depleted bovine liver catalase complexed with 3-amino-1,2,4-triazole
PDB Compounds: (A:) catalase

SCOP Domain Sequences for d1th4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1th4a1 e.5.1.1 (A:3-501) Catalase I {Cow (Bos taurus) [TaxId: 9913]}
nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
dvhpeygsriqalldkyne

SCOP Domain Coordinates for d1th4a1:

Click to download the PDB-style file with coordinates for d1th4a1.
(The format of our PDB-style files is described here.)

Timeline for d1th4a1: