Lineage for d1th3d_ (1th3 D:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1233542Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 1233543Superfamily e.5.1: Heme-dependent catalase-like [56634] (2 families) (S)
  5. 1233544Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 1233689Protein automated matches [190051] (4 species)
    not a true protein
  7. 1233690Species Cow (Bos taurus) [TaxId:9913] [186772] (4 PDB entries)
  8. 1233694Domain d1th3d_: 1th3 D: [119258]
    automated match to d1qqwb_
    complexed with cyn, hem

Details for d1th3d_

PDB Entry: 1th3 (more details), 2.8 Å

PDB Description: Crystal structure of NADPH depleted bovine live catalase complexed with cyanide
PDB Compounds: (D:) catalase

SCOPe Domain Sequences for d1th3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1th3d_ e.5.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
dvhpeygsriqalldkyne

SCOPe Domain Coordinates for d1th3d_:

Click to download the PDB-style file with coordinates for d1th3d_.
(The format of our PDB-style files is described here.)

Timeline for d1th3d_: