SCOP 1.73: Domain d1tgya1: 1tgy A:4-253

Lineage for d1tgya1 (1tgy A:4-253)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Uridine phosphorylase [53176] (2 species)

7. Species Escherichia coli [TaxId:562] [53177] (13 PDB entries)
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP

8. Domain d1tgya1: 1tgy A:4-253 [119249]
   automatically matched to d1k3fa_
   complexed with k, r1p, ura

Details for d1tgya1

PDB Entry: 1tgy, 2.2 Å

PDB Description: structure of e. coli uridine phosphorylase complexed with uracil and ribose 1-phosphate

PDB Compounds: (A:) Uridine phosphorylase

SCOP Domain Sequences for d1tgya1:

Sequence; same for both SEQRES and ATOM records:

>d1tgya1 c.56.2.1 (A:4-253) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Timeline for d1tgya1:

• d1tgya1 is new in SCOP 1.73
  
• d1tgya1 appears in SCOP 1.75
  
• d1tgya1 appears in the current release, SCOPe 2.08, called d1tgya_