SCOP 1.75: Domain d1tgvb1: 1tgv B:4-253

Lineage for d1tgvb1 (1tgv B:4-253)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Uridine phosphorylase [53176] (2 species)

7. Species Escherichia coli [TaxId:562] [53177] (13 PDB entries)
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP
   also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP

8. Domain d1tgvb1: 1tgv B:4-253 [119248]
   automatically matched to d1k3fa_
   complexed with 5ud, k, so4

Details for d1tgvb1

PDB Entry: 1tgv, 2.2 Å

PDB Description: Structure of E. coli Uridine Phosphorylase complexed with 5-Fluorouridine and sulfate

PDB Compounds: (B:) Uridine phosphorylase

SCOP Domain Sequences for d1tgvb1:

Sequence, based on SEQRES records:

>d1tgvb1 c.56.2.1 (B:4-253) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records):

>d1tgvb1 c.56.2.1 (B:4-253) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqmkqteshavkivveaarr
ll

Timeline for d1tgvb1:

• d1tgvb1 first appeared in SCOP 1.73
  
• d1tgvb1 is called d1tgvb_ in SCOPe 2.01
  
• d1tgvb1 appears in the current release, SCOPe 2.08, called d1tgvb_