Lineage for d1tgva_ (1tgv A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1375163Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1375179Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1375180Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1375566Protein Uridine phosphorylase [53176] (5 species)
  7. 1375567Species Escherichia coli [TaxId:562] [53177] (15 PDB entries)
  8. 1375600Domain d1tgva_: 1tgv A: [119247]
    automated match to d1k3fa_
    complexed with 5ud, k, so4

Details for d1tgva_

PDB Entry: 1tgv (more details), 2.2 Å

PDB Description: Structure of E. coli Uridine Phosphorylase complexed with 5-Fluorouridine and sulfate
PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d1tgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgva_ c.56.2.1 (A:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOPe Domain Coordinates for d1tgva_:

Click to download the PDB-style file with coordinates for d1tgva_.
(The format of our PDB-style files is described here.)

Timeline for d1tgva_: