Lineage for d1tguc_ (1tgu C:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2245760Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2245761Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2245762Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2245914Protein automated matches [190051] (6 species)
    not a true protein
  7. 2245915Species Cow (Bos taurus) [TaxId:9913] [186772] (5 PDB entries)
  8. 2245926Domain d1tguc_: 1tgu C: [119245]
    automated match to d1qqwb_
    complexed with hem

Details for d1tguc_

PDB Entry: 1tgu (more details), 2.8 Å

PDB Description: The crystal structure of bovine liver catalase without NADPH
PDB Compounds: (C:) catalase

SCOPe Domain Sequences for d1tguc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tguc_ e.5.1.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
dvhpeygsriqalldkyne

SCOPe Domain Coordinates for d1tguc_:

Click to download the PDB-style file with coordinates for d1tguc_.
(The format of our PDB-style files is described here.)

Timeline for d1tguc_: