Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (4 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein) |
Protein Clp protease, ClpP subunit [52098] (5 species) |
Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141995] (1 PDB entry) |
Domain d1tg6e1: 1tg6 E:1-193 [119240] automatically matched to 1TG6 A:1-193 complexed with dio, edo, gol |
PDB Entry: 1tg6 (more details), 2.1 Å
SCOP Domain Sequences for d1tg6e1:
Sequence, based on SEQRES records: (download)
>d1tg6e1 c.14.1.1 (E:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih myinspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq efgildkvlvhpp
>d1tg6e1 c.14.1.1 (E:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl vhpp
Timeline for d1tg6e1: