Lineage for d1tg6e1 (1tg6 E:1-193)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690607Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein)
  6. 690608Protein Clp protease, ClpP subunit [52098] (5 species)
  7. 690678Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141995] (1 PDB entry)
  8. 690683Domain d1tg6e1: 1tg6 E:1-193 [119240]
    automatically matched to 1TG6 A:1-193
    complexed with dio, edo, gol

Details for d1tg6e1

PDB Entry: 1tg6 (more details), 2.1 Å

PDB Description: crystallography and mutagenesis point to an essential role for the n- terminus of human mitochondrial clpp
PDB Compounds: (E:) Putative ATP-dependent Clp protease proteolytic subunit

SCOP Domain Sequences for d1tg6e1:

Sequence, based on SEQRES records: (download)

>d1tg6e1 c.14.1.1 (E:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
myinspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
efgildkvlvhpp

Sequence, based on observed residues (ATOM records): (download)

>d1tg6e1 c.14.1.1 (E:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv
vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar
gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl
vhpp

SCOP Domain Coordinates for d1tg6e1:

Click to download the PDB-style file with coordinates for d1tg6e1.
(The format of our PDB-style files is described here.)

Timeline for d1tg6e1: