Lineage for d1tfoa_ (1tfo A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1052055Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
    alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander
  4. 1052056Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) (S)
  5. 1052057Family d.243.1.1: Colicin D nuclease domain [102825] (1 protein)
  6. 1052058Protein Colicin D nuclease domain [102826] (1 species)
    tRNA-specific ribonuclease
  7. 1052059Species Escherichia coli [TaxId:562] [102827] (3 PDB entries)
  8. 1052062Domain d1tfoa_: 1tfo A: [119233]
    Other proteins in same PDB: d1tfob_
    automated match to d1v74a_

Details for d1tfoa_

PDB Entry: 1tfo (more details), 2.3 Å

PDB Description: Ribonuclease from Escherichia coli complexed with its inhibitor protein
PDB Compounds: (A:) Colicin D

SCOPe Domain Sequences for d1tfoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfoa_ d.243.1.1 (A:) Colicin D nuclease domain {Escherichia coli [TaxId: 562]}
ldsgrfsrkqldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyrrekg
skvyfnpntmnvviiksngeflsgwkinpdadngriyletgel

SCOPe Domain Coordinates for d1tfoa_:

Click to download the PDB-style file with coordinates for d1tfoa_.
(The format of our PDB-style files is described here.)

Timeline for d1tfoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tfob_