Lineage for d1tfoa1 (1tfo A:595-697)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881363Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
    alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander
  4. 881364Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) (S)
  5. 881365Family d.243.1.1: Colicin D nuclease domain [102825] (1 protein)
  6. 881366Protein Colicin D nuclease domain [102826] (1 species)
    tRNA-specific ribonuclease
  7. 881367Species Escherichia coli [TaxId:562] [102827] (2 PDB entries)
  8. 881369Domain d1tfoa1: 1tfo A:595-697 [119233]
    Other proteins in same PDB: d1tfob1
    automatically matched to d1v74a_

Details for d1tfoa1

PDB Entry: 1tfo (more details), 2.3 Å

PDB Description: Ribonuclease from Escherichia coli complexed with its inhibitor protein
PDB Compounds: (A:) Colicin D

SCOP Domain Sequences for d1tfoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfoa1 d.243.1.1 (A:595-697) Colicin D nuclease domain {Escherichia coli [TaxId: 562]}
ldsgrfsrkqldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyrrekg
skvyfnpntmnvviiksngeflsgwkinpdadngriyletgel

SCOP Domain Coordinates for d1tfoa1:

Click to download the PDB-style file with coordinates for d1tfoa1.
(The format of our PDB-style files is described here.)

Timeline for d1tfoa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tfob1