Lineage for d1tfoa1 (1tfo A:595-697)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meanderSuperfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) 
Family d.243.1.1: Colicin D nuclease domain [102825] (1 protein) Protein Colicin D nuclease domain [102826] (1 species)
tRNA-specific ribonucleaseSpecies Escherichia coli [TaxId:562] [102827] (2 PDB entries) 
Domain d1tfoa1: 1tfo A:595-697 [119233]
Other proteins in same PDB: d1tfob1
automatically matched to d1v74a_
Details for d1tfoa1
PDB Entry: 1tfo (more details), 2.3 Å
PDB Description: Ribonuclease from Escherichia coli complexed with its inhibitor protein
PDB Compounds: (A:) Colicin DSCOP Domain Sequences for d1tfoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfoa1 d.243.1.1 (A:595-697) Colicin D nuclease domain {Escherichia coli [TaxId: 562]}
ldsgrfsrkqldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyrrekg
skvyfnpntmnvviiksngeflsgwkinpdadngriyletgel
SCOP Domain Coordinates for d1tfoa1:
Click to download the PDB-style file with coordinates for d1tfoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tfoa1:
- d1tfoa1 first appeared in SCOP 1.73
- d1tfoa1 is called d1tfoa_ in SCOPe 2.01
- d1tfoa1 appears in the current release, SCOPe 2.08, called d1tfoa_
View in 3D
