Lineage for d1tfkb2 (1tfk B:3-87)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313981Superfamily a.24.20: Colicin D immunity protein [101125] (1 family) (S)
    automatically mapped to Pfam PF09204
  5. 2313982Family a.24.20.1: Colicin D immunity protein [101126] (2 proteins)
  6. 2313986Protein automated matches [190050] (1 species)
    not a true protein
  7. 2313987Species Escherichia coli [TaxId:562] [186771] (2 PDB entries)
  8. 2313989Domain d1tfkb2: 1tfk B:3-87 [119232]
    Other proteins in same PDB: d1tfka_, d1tfkb3
    automated match to d1v74b_
    complexed with mes

Details for d1tfkb2

PDB Entry: 1tfk (more details), 2.1 Å

PDB Description: ribonuclease from escherichia coli complexed with its inhibtor protein
PDB Compounds: (B:) Colicin D immunity protein

SCOPe Domain Sequences for d1tfkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfkb2 a.24.20.1 (B:3-87) automated matches {Escherichia coli [TaxId: 562]}
kmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepda
dranyeiddnglkvevrsilekfkl

SCOPe Domain Coordinates for d1tfkb2:

Click to download the PDB-style file with coordinates for d1tfkb2.
(The format of our PDB-style files is described here.)

Timeline for d1tfkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfkb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1tfka_