Lineage for d1tf9a_ (1tf9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2126919Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 protein domains)
  6. 2127040Protein automated matches [190049] (2 species)
    not a true protein
  7. 2127041Species Streptomyces griseus [TaxId:1911] [186770] (6 PDB entries)
  8. 2127046Domain d1tf9a_: 1tf9 A: [119231]
    automated match to d1cp7a_
    complexed with ca, phi, zn

Details for d1tf9a_

PDB Entry: 1tf9 (more details), 1.3 Å

PDB Description: Streptomyces griseus aminopeptidase complexed with P-Iodo-L-Phenylalanine
PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d1tf9a_:

Sequence, based on SEQRES records: (download)

>d1tf9a_ c.56.5.4 (A:) automated matches {Streptomyces griseus [TaxId: 1911]}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

Sequence, based on observed residues (ATOM records): (download)

>d1tf9a_ c.56.5.4 (A:) automated matches {Streptomyces griseus [TaxId: 1911]}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegrsdhapfknvgvpvgglftgagytksaaqaqkwggtagqaf
drcyhsscdslsnindtaldrnsdaaahaiwtlss

SCOPe Domain Coordinates for d1tf9a_:

Click to download the PDB-style file with coordinates for d1tf9a_.
(The format of our PDB-style files is described here.)

Timeline for d1tf9a_: