![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) ![]() |
![]() | Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) |
![]() | Protein Carbonic anhydrase [51071] (10 species) |
![]() | Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (197 PDB entries) |
![]() | Domain d1teqx1: 1teq X:3-261 [119228] automatically matched to d1can__ complexed with oh, zn |
PDB Entry: 1teq (more details), 2 Å
SCOP Domain Sequences for d1teqx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1teqx1 b.74.1.1 (X:3-261) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd nwrpaqplknrqikasfk
Timeline for d1teqx1: