Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) |
Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins) duplication: consists of two domains of this fold |
Protein Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 [143166] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143167] (1 PDB entry) Uniprot P41903 13-116 |
Domain d1tbuc1: 1tbu C:14-116 [119225] automatically matched to 1TBU A:13-116 complexed with fmt |
PDB Entry: 1tbu (more details), 2.2 Å
SCOP Domain Sequences for d1tbuc1:
Sequence, based on SEQRES records: (download)
>d1tbuc1 d.38.1.3 (C:14-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvplnffptslhsyfikg gdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfav
>d1tbuc1 d.38.1.3 (C:14-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ilelvplsptsfvtkylptfggtlvsqsllaslhtvplnffptslhsyfikggdprtkit yhvqnlrngrnfihkqvsayqhdkliftsmilfav
Timeline for d1tbuc1: