SCOPe 2.07: Domain d1tbub_: 1tbu B:

Lineage for d1tbub_ (1tbu B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins)
   duplication: consists of two domains of this fold

6. Protein Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 [143166] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143167] (1 PDB entry)
   Uniprot P41903 13-116

8. Domain d1tbub_: 1tbu B: [119224]
   automated match to d1tbua1
   complexed with fmt

Details for d1tbub_

PDB Entry: 1tbu, 2.2 Å

PDB Description: Crystal structure of N-terminal domain of yeast peroxisomal thioesterase-1

PDB Compounds: (B:) Peroxisomal acyl-coenzyme A thioester hydrolase 1

SCOPe Domain Sequences for d1tbub_:

Sequence, based on SEQRES records:

>d1tbub_ d.38.1.3 (B:) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvplnffptslhsyfik
ggdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfavqr

Sequence, based on observed residues (ATOM records):

>d1tbub_ d.38.1.3 (B:) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylgtfggtlvsqsllaslhtvplnffptslhsyfikggdprtki
tyhvqnlrngrnfihkqvsayqhdkliftsmilfavqr

Timeline for d1tbub_:

• d1tbub_ first appeared in SCOP 1.73, called d1tbub1
  
• d1tbub_ appears in SCOPe 2.06
  
• d1tbub_ appears in the current release, SCOPe 2.08