SCOP 1.75: Domain d1tbub1: 1tbu B:13-116

Lineage for d1tbub1 (1tbu B:13-116)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins)
   duplication: consists of two domains of this fold

6. Protein Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 [143166] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143167] (1 PDB entry)
   Uniprot P41903 13-116

8. Domain d1tbub1: 1tbu B:13-116 [119224]
   automatically matched to 1TBU A:13-116
   complexed with fmt

Details for d1tbub1

PDB Entry: 1tbu, 2.2 Å

PDB Description: Crystal structure of N-terminal domain of yeast peroxisomal thioesterase-1

PDB Compounds: (B:) Peroxisomal acyl-coenzyme A thioester hydrolase 1

SCOP Domain Sequences for d1tbub1:

Sequence, based on SEQRES records:

>d1tbub1 d.38.1.3 (B:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvplnffptslhsyfik
ggdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfav

Sequence, based on observed residues (ATOM records):

>d1tbub1 d.38.1.3 (B:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylgtfggtlvsqsllaslhtvplnffptslhsyfikggdprtki
tyhvqnlrngrnfihkqvsayqhdkliftsmilfav

Timeline for d1tbub1:

• d1tbub1 first appeared in SCOP 1.73
  
• d1tbub1 is called d1tbub_ in SCOPe 2.01
  
• d1tbub1 appears in the current release, SCOPe 2.08, called d1tbub_