Lineage for d1tbub1 (1tbu B:13-116)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721480Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins)
    duplication: consists of two domains of this fold
  6. 721481Protein Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 [143166] (1 species)
  7. 721482Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143167] (1 PDB entry)
  8. 721484Domain d1tbub1: 1tbu B:13-116 [119224]
    automatically matched to 1TBU A:13-116
    complexed with fmt

Details for d1tbub1

PDB Entry: 1tbu (more details), 2.2 Å

PDB Description: Crystal structure of N-terminal domain of yeast peroxisomal thioesterase-1
PDB Compounds: (B:) Peroxisomal acyl-coenzyme A thioester hydrolase 1

SCOP Domain Sequences for d1tbub1:

Sequence, based on SEQRES records: (download)

>d1tbub1 d.38.1.3 (B:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylpaapvgskgtfggtlvsqsllaslhtvplnffptslhsyfik
ggdprtkityhvqnlrngrnfihkqvsayqhdkliftsmilfav

Sequence, based on observed residues (ATOM records): (download)

>d1tbub1 d.38.1.3 (B:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kilelvplsptsfvtkylgtfggtlvsqsllaslhtvplnffptslhsyfikggdprtki
tyhvqnlrngrnfihkqvsayqhdkliftsmilfav

SCOP Domain Coordinates for d1tbub1:

Click to download the PDB-style file with coordinates for d1tbub1.
(The format of our PDB-style files is described here.)

Timeline for d1tbub1: