Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) |
Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins) Pfam PF00491 |
Protein Arginase [52770] (5 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (31 PDB entries) |
Domain d1tbjb1: 1tbj B:6-319 [119217] automatically matched to 1TBJ A:6-319 complexed with gol, mn; mutant |
PDB Entry: 1tbj (more details), 2.8 Å
SCOP Domain Sequences for d1tbjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbjb1 c.42.1.1 (B:6-319) Arginase {Rat (Rattus norvegicus) [TaxId: 10116]} kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda htdintplttssgnlagqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg tkregnhkpetdyl
Timeline for d1tbjb1: