Lineage for d1tbha1 (1tbh A:6-319)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481831Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2481832Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2481833Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2481854Protein Arginase [52770] (5 species)
  7. 2481997Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
    Uniprot P07824
  8. 2482055Domain d1tbha1: 1tbh A:6-319 [119213]
    complexed with mn; mutant

Details for d1tbha1

PDB Entry: 1tbh (more details), 2.7 Å

PDB Description: h141d mutant of rat liver arginase i
PDB Compounds: (A:) arginase 1

SCOPe Domain Sequences for d1tbha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbha1 c.42.1.1 (A:6-319) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnldgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

SCOPe Domain Coordinates for d1tbha1:

Click to download the PDB-style file with coordinates for d1tbha1.
(The format of our PDB-style files is described here.)

Timeline for d1tbha1: