Lineage for d1tb3d1 (1tb3 D:1-349)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814735Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 814736Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 814890Protein Hydroxyacid oxidase [141761] (1 species)
  7. 814891Species Rat (Rattus norvegicus) [TaxId:10116] [141762] (1 PDB entry)
    Uniprot Q07523 1-349
  8. 814895Domain d1tb3d1: 1tb3 D:1-349 [119208]
    automatically matched to 1TB3 A:1-349
    complexed with acy, fmn

Details for d1tb3d1

PDB Entry: 1tb3 (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of Recombinant Rat Kidney Long-chain Hydroxy Acid Oxidase
PDB Compounds: (D:) Hydroxyacid oxidase 3

SCOP Domain Sequences for d1tb3d1:

Sequence, based on SEQRES records: (download)

>d1tb3d1 c.1.4.1 (D:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]}
plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqf

Sequence, based on observed residues (ATOM records): (download)

>d1tb3d1 c.1.4.1 (D:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]}
plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnlealral
kasfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsasid
alrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvkevl
diltaelhrcmtlsgcqsvaeispdliqf

SCOP Domain Coordinates for d1tb3d1:

Click to download the PDB-style file with coordinates for d1tb3d1.
(The format of our PDB-style files is described here.)

Timeline for d1tb3d1: