Lineage for d1tb3d_ (1tb3 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2080567Species Norway rat (Rattus norvegicus) [TaxId:10116] [186769] (1 PDB entry)
  8. 2080570Domain d1tb3d_: 1tb3 D: [119208]
    Other proteins in same PDB: d1tb3a1
    automated match to d1gyla_
    complexed with acy, fmn

Details for d1tb3d_

PDB Entry: 1tb3 (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of Recombinant Rat Kidney Long-chain Hydroxy Acid Oxidase
PDB Compounds: (D:) Hydroxyacid oxidase 3

SCOPe Domain Sequences for d1tb3d_:

Sequence, based on SEQRES records: (download)

>d1tb3d_ c.1.4.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqf

Sequence, based on observed residues (ATOM records): (download)

>d1tb3d_ c.1.4.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnlealral
kasfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsasid
alrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvkevl
diltaelhrcmtlsgcqsvaeispdliqf

SCOPe Domain Coordinates for d1tb3d_:

Click to download the PDB-style file with coordinates for d1tb3d_.
(The format of our PDB-style files is described here.)

Timeline for d1tb3d_: