Lineage for d1tb3a1 (1tb3 A:1-349)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080267Protein Hydroxyacid oxidase [141761] (1 species)
  7. 2080268Species Norway rat (Rattus norvegicus) [TaxId:10116] [141762] (1 PDB entry)
    Uniprot Q07523 1-349
  8. 2080269Domain d1tb3a1: 1tb3 A:1-349 [119205]
    Other proteins in same PDB: d1tb3b_, d1tb3c_, d1tb3d_, d1tb3e_, d1tb3f_, d1tb3g_, d1tb3h_
    complexed with acy, fmn

Details for d1tb3a1

PDB Entry: 1tb3 (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of Recombinant Rat Kidney Long-chain Hydroxy Acid Oxidase
PDB Compounds: (A:) Hydroxyacid oxidase 3

SCOPe Domain Sequences for d1tb3a1:

Sequence, based on SEQRES records: (download)

>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqf

Sequence, based on observed residues (ATOM records): (download)

>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleakdlr
alkeasfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsa
sidalrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvk
evldiltaelhrcmtlsgcqsvaeispdliqf

SCOPe Domain Coordinates for d1tb3a1:

Click to download the PDB-style file with coordinates for d1tb3a1.
(The format of our PDB-style files is described here.)

Timeline for d1tb3a1: