SCOP 1.73: Domain d1ta1c1: 1ta1 C:6-319

Lineage for d1ta1c1 (1ta1 C:6-319)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (2 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
   Pfam PF00491

6. Protein Arginase [52770] (5 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (31 PDB entries)

8. Domain d1ta1c1: 1ta1 C:6-319 [119203]
   automatically matched to d1hqga_
   complexed with gol, mn; mutant

Details for d1ta1c1

PDB Entry: 1ta1, 2.5 Å

PDB Description: h141c mutant of rat liver arginase i

PDB Compounds: (C:) arginase 1

SCOP Domain Sequences for d1ta1c1:

Sequence; same for both SEQRES and ATOM records:

>d1ta1c1 c.42.1.1 (C:6-319) Arginase {Rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlcgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

Timeline for d1ta1c1:

• d1ta1c1 is new in SCOP 1.73
  
• d1ta1c1 appears in SCOP 1.75
  
• d1ta1c1 appears in the current release, SCOPe 2.08, called d1ta1c_