Lineage for d1ta1b_ (1ta1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2873863Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2873884Protein Arginase [52770] (5 species)
  7. 2874027Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
    Uniprot P07824
  8. 2874054Domain d1ta1b_: 1ta1 B: [119202]
    automated match to d1hqfa_
    complexed with gol, mn; mutant

Details for d1ta1b_

PDB Entry: 1ta1 (more details), 2.5 Å

PDB Description: h141c mutant of rat liver arginase i
PDB Compounds: (B:) arginase 1

SCOPe Domain Sequences for d1ta1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ta1b_ c.42.1.1 (B:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlcgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

SCOPe Domain Coordinates for d1ta1b_:

Click to download the PDB-style file with coordinates for d1ta1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ta1b_: