Lineage for d1t98b2 (1t98 B:119-281)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770353Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 770407Superfamily a.47.6: MukF C-terminal domain-like [140570] (1 family) (S)
  5. 770408Family a.47.6.1: MukF C-terminal domain-like [140571] (1 protein)
    C-terminal part of Pfam PF03882
  6. 770409Protein Chromosome partition protein MukF (KicB), C-terminal domain [140572] (1 species)
  7. 770410Species Escherichia coli [TaxId:562] [140573] (1 PDB entry)
    Uniprot P60293 119-281
  8. 770412Domain d1t98b2: 1t98 B:119-281 [119199]
    Other proteins in same PDB: d1t98a1, d1t98b1
    automatically matched to 1T98 A:119-281

Details for d1t98b2

PDB Entry: 1t98 (more details), 2.9 Å

PDB Description: crystal structure of mukf(1-287)
PDB Compounds: (B:) Chromosome partition protein mukF

SCOP Domain Sequences for d1t98b2:

Sequence, based on SEQRES records: (download)

>d1t98b2 a.47.6.1 (B:119-281) Chromosome partition protein MukF (KicB), C-terminal domain {Escherichia coli [TaxId: 562]}
efstlrlsmqlsivagelkraadaaeeggdefhwhrnvyaplkysvaeifdsidltqrlm
deqqqqvkddiaqllnkdwraaisscelllsetsgtlrelqdtleaagdklqanllriqd
atmthddlhfvdrlvfdlqskldriiswgqqsidlwigydrhv

Sequence, based on observed residues (ATOM records): (download)

>d1t98b2 a.47.6.1 (B:119-281) Chromosome partition protein MukF (KicB), C-terminal domain {Escherichia coli [TaxId: 562]}
efstlrlsmqlsivagelkraadaaeeggdefhwhrnvyaplkysvaeifdsidltqrlm
deqqqqvkddiaqllnisscelllsetsgtlrelqdtleaagdklqanllriqdahddlh
fvdrlvfdlqskldriiswgqqsidlwigydrhv

SCOP Domain Coordinates for d1t98b2:

Click to download the PDB-style file with coordinates for d1t98b2.
(The format of our PDB-style files is described here.)

Timeline for d1t98b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t98b1